PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013595546.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 377aa    MW: 41360.3 Da    PI: 7.9642
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013595546.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding482.8e-153984147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g W+ eEd  l ++v+++G+++W++ ar ++ gR++k+c++rw + 
   XP_013595546.1 39 KGTWSGEEDVMLSELVEMFGPRNWSSMARSIP-GRSGKSCRLRWCNQ 84
                     799*****************************.***********985 PP

2Myb_DNA-binding51.32.7e-1691133145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      r+++T+ Ede ++ a++ +G++ W+ Ia+ ++ gRt++ +k++w+
   XP_013595546.1  91 RNPFTEVEDEAIITAHAIHGNK-WSIIAKLLP-GRTDNAIKNHWN 133
                      789*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.2613485IPR017930Myb domain
SuperFamilySSF466892.55E-2937132IPR009057Homeodomain-like
SMARTSM007177.2E-143887IPR001005SANT/Myb domain
PfamPF002498.6E-153984IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-224092IPR009057Homeodomain-like
CDDcd001671.51E-124183No hitNo description
PROSITE profilePS5129425.78786140IPR017930Myb domain
SMARTSM007174.2E-1690138IPR001005SANT/Myb domain
PfamPF002494.1E-1491133IPR001005SANT/Myb domain
CDDcd001675.41E-1293136No hitNo description
Gene3DG3DSA:1.10.10.604.8E-2393139IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MWRRSGIGEM AVAGGRRDDG VAMFVGEGTS GRRRKKRIKG TWSGEEDVML SELVEMFGPR  60
NWSSMARSIP GRSGKSCRLR WCNQLDPSLK RNPFTEVEDE AIITAHAIHG NKWSIIAKLL  120
PGRTDNAIKN HWNATLRRRC TDFETPTTNT PTGNLLLQDS RLDRTMNTFA SSEETLSSGG  180
GGGGGGHVTT PIVSSDGKEA TSMNISEEQP SDKANEEDIS RQVCNDPPTL FRPVAKLSSF  240
NPYNHMEGSS TPHTLNQNKF QSCKQDTAML RLVEGAYSER FVPQKCGSGC CSVSQKDSLL  300
GPEFVDYLDP PTFPSYELAA IATDISSLAW LRSGLESSSV RAMEEAAGRL RPQGTRGHRD  360
HCLVSEQGKS RTNVLST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-353814057159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-353814057159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13136RRRKKR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00337DAPTransfer from AT3G09230Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9747500.0KF974750.1 Brassica napus MYB transcription factor 1 (MYB1.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013595546.10.0PREDICTED: transcription factor MYB48-like
TrEMBLA0A0D3DHZ00.0A0A0D3DHZ0_BRAOL; Uncharacterized protein
STRINGBra034057.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM84922636
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09230.11e-173myb domain protein 1